SCOP 1.69: Domain d1thda1: 1thd A:298-395

Lineage for d1thda1 (1thd A:298-395)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Envelope glycoprotein [49213] (4 species)

7. Species Dengue virus type 2 [TaxId:12637] [89194] (6 PDB entries)

8. Domain d1thda1: 1thd A:298-395 [106910]
   Other proteins in same PDB: d1thda2, d1thdb2, d1thdc2

Details for d1thda1

PDB Entry: 1thd, 9.5 Å

PDB Description: complex organization of dengue virus e protein as revealed by 9.5 angstrom cryo-em reconstruction

SCOP Domain Sequences for d1thda1:

Sequence; same for both SEQRES and ATOM records:

>d1thda1 b.1.18.4 (A:298-395) Envelope glycoprotein {Dengue virus type 2}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg

Timeline for d1thda1:

• d1thda1 is new in SCOP 1.69
  
• d1thda1 appears in SCOP 1.71
  
• d1thda1 appears in the current release, SCOPe 2.08