Lineage for d1szpb1 (1szp B:89-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715792Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715793Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 2715794Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. 2715795Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (2 PDB entries)
    Uniprot P25454 81-395
  8. 2715798Domain d1szpb1: 1szp B:89-144 [106178]
    Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2
    complexed with so4

Details for d1szpb1

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: a crystal structure of the rad51 filament
PDB Compounds: (B:) DNA repair protein rad51

SCOPe Domain Sequences for d1szpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szpb1 a.60.4.1 (B:89-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlvpmgf

SCOPe Domain Coordinates for d1szpb1:

Click to download the PDB-style file with coordinates for d1szpb1.
(The format of our PDB-style files is described here.)

Timeline for d1szpb1: