PDB entry 1szp

View 1szp on RCSB PDB site
Description: A Crystal Structure of the Rad51 Filament
Class: DNA binding protein
Keywords: homologous recombination, asymmetry, Rad51 filament, DNA BINDING PROTEIN
Deposited on 2004-04-06, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.273
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25454 (1-End)
      • initiating methionine (0)
      • engineered (265)
    Domains in SCOPe 2.06: d1szpa1, d1szpa2
  • Chain 'B':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1szpb1, d1szpb2
  • Chain 'C':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1szpc1, d1szpc2
  • Chain 'D':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25454 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d1szpd1, d1szpd2
  • Chain 'E':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25454 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d1szpe1, d1szpe2
  • Chain 'F':
    Compound: DNA repair protein rad51
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD51, YER095W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25454 (1-End)
      • initiating methionine (0)
      • engineered (265)
    Domains in SCOPe 2.06: d1szpf1, d1szpf2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szpA (A:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpA (A:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdelsarqmhlakfmralqrladqfgvavvvt
    nqvvtggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szpB (B:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpB (B:)
    ngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlvpmgfvtaa
    dfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqipldi
    gggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrlldaaaqm
    msesrfslivvdsvmalyrelsarqmhlakfmralqrladqfgvavvvtnqvggnimahs
    sttrlgfkkgkgcqrlckvvecvfaiyedgvgdp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1szpC (C:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpC (C:)
    ngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlvpmgfvtaa
    dfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqipldi
    gggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrlldaaaqm
    msesrfslivvdsvmalyrelsarqmhlakfmralqrladqfgvavvvtnqvggnimahs
    sttrlgfkkgkgcqrlckvvecvfaiyedgvgdp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1szpD (D:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpD (D:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdelsarqmhlakfmralqrladqfgvavvvt
    nqvggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1szpE (E:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpE (E:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfelsarqmhlakfmralqrladqfgvavvv
    tnqvggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1szpF (F:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpF (F:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdelsarqmhlakfmralqrladqfgvavvvt
    nqvtggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp