![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
![]() | Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (2 PDB entries) Uniprot P25454 81-395 |
![]() | Domain d1szpd1: 1szp D:81-144 [106182] Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2 complexed with so4 |
PDB Entry: 1szp (more details), 3.25 Å
SCOPe Domain Sequences for d1szpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szpd1 a.60.4.1 (D:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv pmgf
Timeline for d1szpd1: