Lineage for d1szpf1 (1szp F:81-144)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (2 PDB entries)
    Uniprot P25454 81-395
  8. Domain d1szpf1: 1szp F:81-144 [106186]
    Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2
    complexed with so4

Details for d1szpf1

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: A Crystal Structure of the Rad51 Filament
PDB Compounds: (F:) DNA repair protein rad51

SCOPe Domain Sequences for d1szpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szpf1 a.60.4.1 (F:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv
pmgf

SCOPe Domain Coordinates for d1szpf1 are not available.

Timeline for d1szpf1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szpf2
View in 3D
Domains from other chains:
(mouse over for more information)
d1szpa1, d1szpa2, d1szpb1, d1szpb2, d1szpc1, d1szpc2, d1szpd1, d1szpd2, d1szpe1, d1szpe2