SCOP 1.69: Domain d1szpb1: 1szp B:89-144

Lineage for d1szpb1 (1szp B:89-144)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (1 PDB entry)

8. Domain d1szpb1: 1szp B:89-144 [106178]
   Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2

Details for d1szpb1

PDB Entry: 1szp, 3.25 Å

PDB Description: a crystal structure of the rad51 filament

SCOP Domain Sequences for d1szpb1:

Sequence; same for both SEQRES and ATOM records:

>d1szpb1 a.60.4.1 (B:89-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlvpmgf

Timeline for d1szpb1:

• d1szpb1 is new in SCOP 1.69
  
• d1szpb1 appears in SCOP 1.71
  
• d1szpb1 appears in the current release, SCOPe 2.08