Lineage for d1q95h2 (1q95 H:101-153)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036845Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 3036846Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 3036847Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 3036848Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
    Uniprot P00478
  8. 3036876Domain d1q95h2: 1q95 H:101-153 [104580]
    Other proteins in same PDB: d1q95a1, d1q95a2, d1q95b1, d1q95b2, d1q95c1, d1q95c2, d1q95d1, d1q95d2, d1q95e1, d1q95e2, d1q95f1, d1q95f2, d1q95g1, d1q95h1, d1q95i1, d1q95j1, d1q95k1, d1q95l1
    complexed with pal, zn

Details for d1q95h2

PDB Entry: 1q95 (more details), 2.46 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
PDB Compounds: (H:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1q95h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q95h2 g.41.7.1 (H:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1q95h2:

Click to download the PDB-style file with coordinates for d1q95h2.
(The format of our PDB-style files is described here.)

Timeline for d1q95h2: