Lineage for d1q95g1 (1q95 G:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949509Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2949510Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2949511Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2949512Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. 2949539Domain d1q95g1: 1q95 G:1-100 [104577]
    Other proteins in same PDB: d1q95a1, d1q95a2, d1q95b1, d1q95b2, d1q95c1, d1q95c2, d1q95d1, d1q95d2, d1q95e1, d1q95e2, d1q95f1, d1q95f2, d1q95g2, d1q95h2, d1q95i2, d1q95j2, d1q95k2, d1q95l2
    complexed with pal, zn

Details for d1q95g1

PDB Entry: 1q95 (more details), 2.46 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
PDB Compounds: (G:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1q95g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q95g1 d.58.2.1 (G:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1q95g1:

Click to download the PDB-style file with coordinates for d1q95g1.
(The format of our PDB-style files is described here.)

Timeline for d1q95g1: