![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
![]() | Domain d1q95i1: 1q95 I:1-100 [104581] Other proteins in same PDB: d1q95a1, d1q95a2, d1q95b1, d1q95b2, d1q95c1, d1q95c2, d1q95d1, d1q95d2, d1q95e1, d1q95e2, d1q95f1, d1q95f2, d1q95g2, d1q95h2, d1q95i2, d1q95j2, d1q95k2, d1q95l2 complexed with pal, zn |
PDB Entry: 1q95 (more details), 2.46 Å
SCOPe Domain Sequences for d1q95i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q95i1 d.58.2.1 (I:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik ientflsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1q95i1: