Lineage for d1q95c2 (1q95 C:151-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906435Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2906443Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 2906513Domain d1q95c2: 1q95 C:151-310 [104570]
    Other proteins in same PDB: d1q95g1, d1q95g2, d1q95h1, d1q95h2, d1q95i1, d1q95i2, d1q95j1, d1q95j2, d1q95k1, d1q95k2, d1q95l1, d1q95l2
    complexed with pal, zn

Details for d1q95c2

PDB Entry: 1q95 (more details), 2.46 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1q95c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q95c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d1q95c2:

Click to download the PDB-style file with coordinates for d1q95c2.
(The format of our PDB-style files is described here.)

Timeline for d1q95c2: