PDB entry 1q95

View 1q95 on RCSB PDB site
Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
Class: transferase
Keywords: Aspartate Transcarbamylase, Aspartate Carbamoyltransferase, N-carbamyl-L-aspartate, PALA, ATCase-PALA Complex, R state
Deposited on 2003-08-22, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95a1, d1q95a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95b1, d1q95b2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95c1, d1q95c2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95d1, d1q95d2
  • Chain 'E':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95e1, d1q95e2
  • Chain 'F':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB OR B4245 OR C5345 OR Z5856 OR ECS5222 OR SF4245 OR S4507
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95f1, d1q95f2
  • Chain 'G':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95g1, d1q95g2
  • Chain 'H':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95h1, d1q95h2
  • Chain 'I':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95i1, d1q95i2
  • Chain 'J':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95j1, d1q95j2
  • Chain 'K':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95k1, d1q95k2
  • Chain 'L':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI OR B4244 OR C5344 OR Z5855 OR ECS5221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q95l1, d1q95l2
  • Heterogens: ZN, PAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95A (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95B (B:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95C (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95D (D:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95E (E:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95F (F:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95G (G:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95H (H:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95I (I:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95J (J:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95K (K:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q95L (L:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan