![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [53674] (62 PDB entries) Uniprot P00479 |
![]() | Domain d1q95e1: 1q95 E:1-150 [104573] Other proteins in same PDB: d1q95g1, d1q95g2, d1q95h1, d1q95h2, d1q95i1, d1q95i2, d1q95j1, d1q95j2, d1q95k1, d1q95k2, d1q95l1, d1q95l2 complexed with pal, zn |
PDB Entry: 1q95 (more details), 2.46 Å
SCOPe Domain Sequences for d1q95e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q95e1 c.78.1.1 (E:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1q95e1: