Lineage for d5jpta1 (5jpt A:3-270)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870799Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43, N-terminal domain [419074] (1 species)
    this first domain contains extended N-terminal (sub)domain described in PubMed 20168331
  7. 2870800Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [419568] (2 PDB entries)
  8. 2870803Domain d5jpta1: 5jpt A:3-270 [345695]
    Other proteins in same PDB: d5jpta2, d5jpta3, d5jpta4, d5jpta5, d5jptb2, d5jptb3, d5jptb4, d5jptb5
    automated match to d3kx2a1
    protein/RNA complex; complexed with act, cdp, gol, mg, ni
    has additional subdomain(s) that are not in the common domain

Details for d5jpta1

PDB Entry: 5jpt (more details), 2.94 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with cdp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d5jpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpta1 c.37.1.19 (A:3-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
skrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsaee
aqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgsgk
ttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfenkt
snktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpdlk
iiimsatldaekfqryfndapllavpgr

SCOPe Domain Coordinates for d5jpta1:

Click to download the PDB-style file with coordinates for d5jpta1.
(The format of our PDB-style files is described here.)

Timeline for d5jpta1: