Lineage for d5jpta3 (5jpt A:455-520)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307158Family a.4.5.87: Helicase RNA-binding domain [345953] (1 protein)
    follows the extended AAA-ATPase domain
  6. 2307159Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346021] (1 species)
    structurally very similar to RecQ DNA helicase winged-helix domain (101030) as reported in PubMed 20168331
  7. 2307160Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346166] (2 PDB entries)
  8. 2307163Domain d5jpta3: 5jpt A:455-520 [345697]
    Other proteins in same PDB: d5jpta1, d5jpta2, d5jpta4, d5jpta5, d5jptb1, d5jptb2, d5jptb4, d5jptb5
    automated match to d3kx2a3
    protein/RNA complex; complexed with act, cdp, gol, mg, ni

Details for d5jpta3

PDB Entry: 5jpt (more details), 2.94 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with cdp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d5jpta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpta3 a.4.5.87 (A:455-520) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
peilrsnlsstvlelkklgiddlvhfdfmdppapetmmraleelnylaclddegnltplg
rlasqf

SCOPe Domain Coordinates for d5jpta3:

Click to download the PDB-style file with coordinates for d5jpta3.
(The format of our PDB-style files is described here.)

Timeline for d5jpta3:

  • d5jpta3 is new in SCOPe 2.07-stable