Lineage for d5jptb5 (5jpt B:635-747)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383825Family b.40.4.17: RNA Helicase C-terminal domain-like [345961] (1 protein)
    Pfam PF07717; contains additional helices
  6. 2383826Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346051] (1 species)
  7. 2383827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346241] (2 PDB entries)
  8. 2383831Domain d5jptb5: 5jpt B:635-747 [345704]
    Other proteins in same PDB: d5jpta1, d5jpta2, d5jpta3, d5jpta4, d5jptb1, d5jptb2, d5jptb3, d5jptb4
    automated match to d3kx2a5
    protein/RNA complex; complexed with act, cdp, gol, mg, ni

Details for d5jptb5

PDB Entry: 5jpt (more details), 2.94 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with cdp
PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d5jptb5:

Sequence, based on SEQRES records: (download)

>d5jptb5 b.40.4.17 (B:635-747) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nttdyespkyfdnirkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewv
iynefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekv

Sequence, based on observed residues (ATOM records): (download)

>d5jptb5 b.40.4.17 (B:635-747) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nttdyespkyfdnirkalasgffmqvakkrgyitvkdnqdvlihpstvlghdaewviyne
fvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekv

SCOPe Domain Coordinates for d5jptb5:

Click to download the PDB-style file with coordinates for d5jptb5.
(The format of our PDB-style files is described here.)

Timeline for d5jptb5:

  • d5jptb5 is new in SCOPe 2.07-stable