SCOPe 2.08: Domain d5jpta5: 5jpt A:635-749

Lineage for d5jpta5 (5jpt A:635-749)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.17: RNA Helicase C-terminal domain-like [345961] (1 protein)
   Pfam PF07717; contains additional helices

6. Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346051] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346241] (2 PDB entries)

8. Domain d5jpta5: 5jpt A:635-749 [345699]
   Other proteins in same PDB: d5jpta1, d5jpta2, d5jpta3, d5jpta4, d5jptb1, d5jptb2, d5jptb3, d5jptb4
   automated match to d3kx2a5
   protein/RNA complex; complexed with act, cdp, gol, mg, ni

Details for d5jpta5

PDB Entry: 5jpt, 2.94 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with cdp

PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d5jpta5:

Sequence, based on SEQRES records:

>d5jpta5 b.40.4.17 (A:635-749) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nttdyespkyfdnirkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewv
iynefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekvdr

Sequence, based on observed residues (ATOM records):

>d5jpta5 b.40.4.17 (A:635-749) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nttdyespkyfdnirkalasgffmqvakkrsggyitvkdnqdvlihpstvlghdaewviy
nefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekvdr

Timeline for d5jpta5:

• d5jpta5 first appeared in SCOPe 2.07