SCOPe 2.08: Domain d5jptb4: 5jpt B:521-634

Lineage for d5jptb4 (5jpt B:521-634)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
   multihelical; consists of two helical subdomains

4. Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families)

5. Family a.289.1.3: Helicase 'ratchet' domain [345959] (1 protein)
   Pfam PF04408; follows the extended AAA-ATPase and winged-helix domains

6. Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346045] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346216] (2 PDB entries)

8. Domain d5jptb4: 5jpt B:521-634 [345703]
   Other proteins in same PDB: d5jpta1, d5jpta2, d5jpta3, d5jpta5, d5jptb1, d5jptb2, d5jptb3, d5jptb5
   automated match to d3kx2a4
   protein/RNA complex; complexed with act, cdp, gol, mg, ni

Details for d5jptb4

PDB Entry: 5jpt, 2.94 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with cdp

PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d5jptb4:

Sequence; same for both SEQRES and ATOM records:

>d5jptb4 a.289.1.3 (B:521-634) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pldpmlavmligsfefqcsqeiltivamlsvpnvfirptkdkkraddaknifahpdgdhi
tllnvyhafksdeayeygihkwcrdhylnyrslsaadnirsqlerlmnrynlel

Timeline for d5jptb4:

• d5jptb4 first appeared in SCOPe 2.07