Lineage for d5h2fv_ (5h2f V:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690853Protein Cytochrome c550 [100991] (3 species)
  7. 2690856Species Thermosynechococcus elongatus [TaxId:197221] [338583] (2 PDB entries)
  8. 2690858Domain d5h2fv_: 5h2f V: [338584]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fx_, d5h2fz_
    automated match to d3a0hv_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fv_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d5h2fv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fv_ a.3.1.1 (V:) Cytochrome c550 {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5h2fv_:

Click to download the PDB-style file with coordinates for d5h2fv_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fv_: