Lineage for d5h2fa_ (5h2f A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027491Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species)
  7. 3027492Species Thermosynechococcus elongatus [TaxId:146786] [161054] (3 PDB entries)
    Uniprot P0A445 10-344
  8. 3027494Domain d5h2fa_: 5h2f A: [338460]
    Other proteins in same PDB: d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d2axta1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fa_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d5h2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fa_ f.26.1.1 (A:) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus elongatus [TaxId: 146786]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d5h2fa_:

Click to download the PDB-style file with coordinates for d5h2fa_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fa_: