Lineage for d5h2ft_ (5h2f T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026547Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 3026548Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 3026549Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 3026562Species Thermosynechococcus elongatus [TaxId:197221] [338493] (1 PDB entry)
  8. 3026563Domain d5h2ft_: 5h2f T: [338494]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d3a0ht_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2ft_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5h2ft_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2ft_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 197221]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d5h2ft_:

Click to download the PDB-style file with coordinates for d5h2ft_.
(The format of our PDB-style files is described here.)

Timeline for d5h2ft_: