![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative transcriptional regulator SCO0857 [140207] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [140208] (1 PDB entry) Uniprot Q9RCV4 35-99 |
![]() | Domain d2np3a1: 2np3 A:35-99 [138420] Other proteins in same PDB: d2np3a2, d2np3b2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2np3 (more details), 2.35 Å
SCOPe Domain Sequences for d2np3a1:
Sequence, based on SEQRES records: (download)
>d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]} iltaarvcfaergfdatslrriaetagvdqslvhhfygtkenlflqalelpgkieeaita aaqgg
>d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]} iltaarvcfygtkenlflqalelpgkieeaitaaaqgg
Timeline for d2np3a1: