Lineage for d2np3a1 (2np3 A:35-99)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Putative transcriptional regulator SCO0857 [140207] (1 species) Species Streptomyces coelicolor [TaxId:1902] [140208] (1 PDB entry)
Uniprot Q9RCV4 35-99
Domain d2np3a1: 2np3 A:35-99 [138420]
Other proteins in same PDB: d2np3a2, d2np3b2
fragment; missing more than one-third of the common structure and/or sequence
Details for d2np3a1
PDB Entry: 2np3 (more details), 2.35 Å
PDB Description: crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
PDB Compounds: (A:) Putative TetR-family regulatorSCOPe Domain Sequences for d2np3a1:
Sequence, based on SEQRES records: (download)
>d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
iltaarvcfaergfdatslrriaetagvdqslvhhfygtkenlflqalelpgkieeaita
aaqgg
Sequence, based on observed residues (ATOM records): (download)
>d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
iltaarvcfygtkenlflqalelpgkieeaitaaaqgg
SCOPe Domain Coordinates for d2np3a1:
Click to download the PDB-style file with coordinates for d2np3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2np3a1:
- d2np3a1 first appeared in SCOP 1.73
- d2np3a1 appears in SCOPe 2.07
View in 3D
