Lineage for d2np3b2 (2np3 B:100-210)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728096Protein Putative transcriptional regulator SCO0857 [140887] (1 species)
  7. 2728097Species Streptomyces coelicolor [TaxId:1902] [140888] (1 PDB entry)
    Uniprot Q9RCV4 100-211
  8. 2728099Domain d2np3b2: 2np3 B:100-210 [138423]
    Other proteins in same PDB: d2np3a1, d2np3b1
    automated match to d2np3a2

Details for d2np3b2

PDB Entry: 2np3 (more details), 2.35 Å

PDB Description: crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
PDB Compounds: (B:) Putative TetR-family regulator

SCOPe Domain Sequences for d2np3b2:

Sequence, based on SEQRES records: (download)

>d2np3b2 a.121.1.1 (B:100-210) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
ldgigervvrahlsvwddvssrpalmtmvrsaaihraaaarlretatgilaralggvitg
edamlrtsmvatqlvglammryvahleplasadtdtvarhygravqaivtd

Sequence, based on observed residues (ATOM records): (download)

>d2np3b2 a.121.1.1 (B:100-210) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
ldgigervvrahlsvwddvssrpalmtmvrsalretatgilaralggvitgedamlrtsm
vatqlvglammryvahleplasadtdtvarhygravqaivtd

SCOPe Domain Coordinates for d2np3b2:

Click to download the PDB-style file with coordinates for d2np3b2.
(The format of our PDB-style files is described here.)

Timeline for d2np3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2np3b1