PDB entry 2np3

View 2np3 on RCSB PDB site
Description: Crystal structure of TetR-family regulator (SCO0857) from Streptomyces coelicolor A3.
Class: transcription
Keywords: TetR, transcriptional regulator, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-10-26, released 2006-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative TetR-family regulator
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO0857
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RCV4
      • modified residue (124)
      • modified residue (126)
      • modified residue (162)
      • modified residue (167)
      • modified residue (177-178)
    Domains in SCOPe 2.08: d2np3a1, d2np3a2
  • Chain 'B':
    Compound: Putative TetR-family regulator
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO0857
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RCV4
      • modified residue (124)
      • modified residue (126)
      • modified residue (162)
      • modified residue (167)
      • modified residue (177-178)
    Domains in SCOPe 2.08: d2np3b1, d2np3b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2np3A (A:)
    mtgqaagpaagpaagqatkhaggrrpgetrtreailtaarvcfaergfdatslrriaeta
    gvdqslvhhfygtkenlflqalelpgkieeaitaaaqggldgigervvrahlsvwddvss
    rpalmtmvrsaaihraaaarlretatgilaralggvitgedamlrtsmvatqlvglammr
    yvahleplasadtdtvarhygravqaivtdrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2np3A (A:)
    iltaarvcfygtkenlflqalelpgkieeaitaaaqggldgigervvrahlsvwddvssr
    palmtmvrsaarlretatgilaralggvitgedamlrtsmvatqlvglammryvahlepl
    asadtdtvarhygravqaivtdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2np3B (B:)
    mtgqaagpaagpaagqatkhaggrrpgetrtreailtaarvcfaergfdatslrriaeta
    gvdqslvhhfygtkenlflqalelpgkieeaitaaaqggldgigervvrahlsvwddvss
    rpalmtmvrsaaihraaaarlretatgilaralggvitgedamlrtsmvatqlvglammr
    yvahleplasadtdtvarhygravqaivtdrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2np3B (B:)
    ggrrpgetrtreailtaarvcfaergfdatslrriaetagvdqslvhhfygtkenlflqa
    lelpgkieeaitaaaqggldgigervvrahlsvwddvssrpalmtmvrsalretatgila
    ralggvitgedamlrtsmvatqlvglammryvahleplasadtdtvarhygravqaivtd