SCOPe 2.08: Domain d2np3b1: 2np3 B:22-99

Lineage for d2np3b1 (2np3 B:22-99)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional regulator SCO0857 [140207] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [140208] (1 PDB entry)
   Uniprot Q9RCV4 35-99

8. Domain d2np3b1: 2np3 B:22-99 [138422]
   Other proteins in same PDB: d2np3a2, d2np3b2
   automated match to d2np3a1

Details for d2np3b1

PDB Entry: 2np3, 2.35 Å

PDB Description: crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.

PDB Compounds: (B:) Putative TetR-family regulator

SCOPe Domain Sequences for d2np3b1:

Sequence; same for both SEQRES and ATOM records:

>d2np3b1 a.4.1.9 (B:22-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
ggrrpgetrtreailtaarvcfaergfdatslrriaetagvdqslvhhfygtkenlflqa
lelpgkieeaitaaaqgg

Timeline for d2np3b1:

• d2np3b1 first appeared in SCOP 1.73
  
• d2np3b1 appears in SCOPe 2.07