Lineage for d2fefa2 (2fef A:135-293)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738371Fold a.254: PA2201 C-terminal domain-like [140730] (1 superfamily)
    multihelical; seven-helical bundle with buried central helix
  4. 2738372Superfamily a.254.1: PA2201 C-terminal domain-like [140731] (1 family) (S)
  5. 2738373Family a.254.1.1: PA2201 C-terminal domain-like [140732] (1 protein)
  6. 2738374Protein Hypothetical protein PA2201 [140733] (1 species)
  7. 2738375Species Pseudomonas aeruginosa [TaxId:287] [140734] (1 PDB entry)
    Uniprot Q9I1R6 135-293
  8. 2738376Domain d2fefa2: 2fef A:135-293 [133344]
    Other proteins in same PDB: d2fefa1, d2fefb1, d2fefc1
    complexed with edo

Details for d2fefa2

PDB Entry: 2fef (more details), 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA2201

SCOPe Domain Sequences for d2fefa2:

Sequence, based on SEQRES records: (download)

>d2fefa2 a.254.1.1 (A:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspkaqkktrrltgpyawg
wwamevsalgvlygwddgvlrasphylgdlvdyarargd

Sequence, based on observed residues (ATOM records): (download)

>d2fefa2 a.254.1.1 (A:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeeasdaqalapylqsqyreffqlspkaqkktrrltgpyawgww
amevsalgvlygwddgvlrasphylgdlvdyarargd

SCOPe Domain Coordinates for d2fefa2:

Click to download the PDB-style file with coordinates for d2fefa2.
(The format of our PDB-style files is described here.)

Timeline for d2fefa2: