SCOP 1.73: Domain d2fefa2: 2fef A:135-293

Lineage for d2fefa2 (2fef A:135-293)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.254: PA2201 C-terminal domain-like [140730] (1 superfamily)
   multihelical; seven-helical bundle with buried central helix

4. Superfamily a.254.1: PA2201 C-terminal domain-like [140731] (1 family)

5. Family a.254.1.1: PA2201 C-terminal domain-like [140732] (1 protein)

6. Protein Hypothetical protein PA2201 [140733] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140734] (1 PDB entry)

8. Domain d2fefa2: 2fef A:135-293 [133344]
   Other proteins in same PDB: d2fefa1, d2fefb1, d2fefc1
   complexed with edo

Details for d2fefa2

PDB Entry: 2fef, 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa

PDB Compounds: (A:) hypothetical protein PA2201

SCOP Domain Sequences for d2fefa2:

Sequence, based on SEQRES records:

>d2fefa2 a.254.1.1 (A:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspkaqkktrrltgpyawg
wwamevsalgvlygwddgvlrasphylgdlvdyarargd

Sequence, based on observed residues (ATOM records):

>d2fefa2 a.254.1.1 (A:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeeasdaqalapylqsqyreffqlspkaqkktrrltgpyawgww
amevsalgvlygwddgvlrasphylgdlvdyarargd

Timeline for d2fefa2:

• d2fefa2 is new in SCOP 1.73
  
• d2fefa2 appears in SCOP 1.75
  
• d2fefa2 appears in the current release, SCOPe 2.08