PDB entry 2fef

View 2fef on RCSB PDB site
Description: The Crystal Structure of Protein PA2201 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: SAD, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, MCSG, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-12-15, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA2201
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2201
    Database cross-references and differences (RAF-indexed):
    • GB AAG05589
    Domains in SCOPe 2.07: d2fefa1, d2fefa2
  • Chain 'B':
    Compound: hypothetical protein PA2201
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2201
    Database cross-references and differences (RAF-indexed):
    • GB AAG05589
    Domains in SCOPe 2.07: d2fefb1, d2fefb2
  • Chain 'C':
    Compound: hypothetical protein PA2201
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2201
    Database cross-references and differences (RAF-indexed):
    • GB AAG05589
    Domains in SCOPe 2.07: d2fefc1, d2fefc2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fefA (A:)
    mhafpltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrq
    pfaaqghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllga
    ardslreqgevdfetapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrl
    ldylgaaalgltsaseetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspka
    qkktrrltgpyawgwwamevsalgvlygwddgvlrasphylgdlvdyarargda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fefA (A:)
    ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
    ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
    reqgetapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaal
    gltsaseetfhprpfgqlraffeeasdaqalapylqsqyreffqlspkaqkktrrltgpy
    awgwwamevsalgvlygwddgvlrasphylgdlvdyarargd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fefB (B:)
    mhafpltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrq
    pfaaqghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllga
    ardslreqgevdfetapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrl
    ldylgaaalgltsaseetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspka
    qkktrrltgpyawgwwamevsalgvlygwddgvlrasphylgdlvdyarargda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fefB (B:)
    ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
    ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
    reqgetapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaal
    gltsaseetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspkaqkktrrltg
    pyawgwwamevsalgvlygwddgvlrasphylgdlvdyarargd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fefC (C:)
    mhafpltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrq
    pfaaqghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllga
    ardslreqgevdfetapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrl
    ldylgaaalgltsaseetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspka
    qkktrrltgpyawgwwamevsalgvlygwddgvlrasphylgdlvdyarargda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fefC (C:)
    ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
    ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
    reqgtapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalg
    ltsaseetfhprpfgqlraffeegsdaqalapylqsqyreffqlspkaqkktrrltgpya
    wgwwamevsalgvlygwddgvlrasphylgdlvdyarargd