SCOPe 2.08: Domain d2fefa1: 2fef A:6-129

Lineage for d2fefa1 (2fef A:6-129)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.11: PA2201 N-terminal domain-like [140486] (1 family)

5. Family a.29.11.1: PA2201 N-terminal domain-like [140487] (1 protein)
   trimerisation domain

6. Protein Hypothetical protein PA2201 [140488] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140489] (1 PDB entry)
   Uniprot Q9I1R6 6-129

8. Domain d2fefa1: 2fef A:6-129 [133343]
   Other proteins in same PDB: d2fefa2, d2fefb2, d2fefc2
   complexed with edo

Details for d2fefa1

PDB Entry: 2fef, 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa

PDB Compounds: (A:) hypothetical protein PA2201

SCOPe Domain Sequences for d2fefa1:

Sequence; same for both SEQRES and ATOM records:

>d2fefa1 a.29.11.1 (A:6-129) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
reqg

Timeline for d2fefa1:

• d2fefa1 first appeared in SCOP 1.73
  
• d2fefa1 appears in SCOPe 2.07