Lineage for d2fefc1 (2fef C:6-129)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708898Superfamily a.29.11: PA2201 N-terminal domain-like [140486] (1 family) (S)
  5. 2708899Family a.29.11.1: PA2201 N-terminal domain-like [140487] (1 protein)
    trimerisation domain
  6. 2708900Protein Hypothetical protein PA2201 [140488] (1 species)
  7. 2708901Species Pseudomonas aeruginosa [TaxId:287] [140489] (1 PDB entry)
    Uniprot Q9I1R6 6-129
  8. 2708904Domain d2fefc1: 2fef C:6-129 [133347]
    Other proteins in same PDB: d2fefa2, d2fefb2, d2fefc2
    automated match to d2fefa1
    complexed with edo

Details for d2fefc1

PDB Entry: 2fef (more details), 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa
PDB Compounds: (C:) hypothetical protein PA2201

SCOPe Domain Sequences for d2fefc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fefc1 a.29.11.1 (C:6-129) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
reqg

SCOPe Domain Coordinates for d2fefc1:

Click to download the PDB-style file with coordinates for d2fefc1.
(The format of our PDB-style files is described here.)

Timeline for d2fefc1: