SCOPe 2.08: Domain d2fefb2: 2fef B:135-293

Lineage for d2fefb2 (2fef B:135-293)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.254: PA2201 C-terminal domain-like [140730] (1 superfamily)
   multihelical; seven-helical bundle with buried central helix

4. Superfamily a.254.1: PA2201 C-terminal domain-like [140731] (1 family)

5. Family a.254.1.1: PA2201 C-terminal domain-like [140732] (1 protein)

6. Protein Hypothetical protein PA2201 [140733] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140734] (1 PDB entry)
   Uniprot Q9I1R6 135-293

8. Domain d2fefb2: 2fef B:135-293 [133346]
   Other proteins in same PDB: d2fefa1, d2fefb1, d2fefc1
   automated match to d2fefa2
   complexed with edo

Details for d2fefb2

PDB Entry: 2fef, 1.9 Å

PDB Description: the crystal structure of protein pa2201 from pseudomonas aeruginosa

PDB Compounds: (B:) hypothetical protein PA2201

SCOPe Domain Sequences for d2fefb2:

Sequence; same for both SEQRES and ATOM records:

>d2fefb2 a.254.1.1 (B:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa
seetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspkaqkktrrltgpyawg
wwamevsalgvlygwddgvlrasphylgdlvdyarargd

Timeline for d2fefb2:

• d2fefb2 first appeared in SCOP 1.73
  
• d2fefb2 appears in SCOPe 2.07