![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.254: PA2201 C-terminal domain-like [140730] (1 superfamily) multihelical; seven-helical bundle with buried central helix |
![]() | Superfamily a.254.1: PA2201 C-terminal domain-like [140731] (1 family) ![]() |
![]() | Family a.254.1.1: PA2201 C-terminal domain-like [140732] (1 protein) |
![]() | Protein Hypothetical protein PA2201 [140733] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140734] (1 PDB entry) Uniprot Q9I1R6 135-293 |
![]() | Domain d2fefc2: 2fef C:135-293 [133348] Other proteins in same PDB: d2fefa1, d2fefb1, d2fefc1 automated match to d2fefa2 complexed with edo |
PDB Entry: 2fef (more details), 1.9 Å
SCOPe Domain Sequences for d2fefc2:
Sequence, based on SEQRES records: (download)
>d2fefc2 a.254.1.1 (C:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]} tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa seetfhprpfgqlraffeeadgsdaqalapylqsqyreffqlspkaqkktrrltgpyawg wwamevsalgvlygwddgvlrasphylgdlvdyarargd
>d2fefc2 a.254.1.1 (C:135-293) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]} tapalaprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsa seetfhprpfgqlraffeegsdaqalapylqsqyreffqlspkaqkktrrltgpyawgww amevsalgvlygwddgvlrasphylgdlvdyarargd
Timeline for d2fefc2:
![]() Domains from other chains: (mouse over for more information) d2fefa1, d2fefa2, d2fefb1, d2fefb2 |