SCOP 1.63: Domain d1n7da3: 1n7d A:333-376

Lineage for d1n7da3 (1n7d A:333-376)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
   disulphide-bound fold; contains beta-hairpin with two adjacent disulphides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (18 proteins)

6. Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64540] (5 PDB entries)

8. Domain d1n7da3: 1n7d A:333-376 [80238]
   Other proteins in same PDB: d1n7da1, d1n7da5, d1n7da6, d1n7da7, d1n7da8, d1n7da9, d1n7daa

Details for d1n7da3

PDB Entry: 1n7d, 3.7 Å

PDB Description: extracellular domain of the ldl receptor

SCOP Domain Sequences for d1n7da3:

Sequence; same for both SEQRES and ATOM records:

>d1n7da3 g.3.11.1 (A:333-376) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
didecqdpdtcsqlcvnleggykcqceegfqldphtkackavgs

Timeline for d1n7da3:

• d1n7da3 is new in SCOP 1.63
  
• d1n7da3 appears in SCOP 1.65
  
• d1n7da3 appears in the current release, SCOPe 2.08