Lineage for d1n7da3 (1n7d A:333-376)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342228Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 342229Species Human (Homo sapiens) [TaxId:9606] [64540] (5 PDB entries)
  8. 342239Domain d1n7da3: 1n7d A:333-376 [80238]
    Other proteins in same PDB: d1n7da1, d1n7da5, d1n7da6, d1n7da7, d1n7da8, d1n7da9, d1n7daa

Details for d1n7da3

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor

SCOP Domain Sequences for d1n7da3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7da3 g.3.11.1 (A:333-376) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
didecqdpdtcsqlcvnleggykcqceegfqldphtkackavgs

SCOP Domain Coordinates for d1n7da3:

Click to download the PDB-style file with coordinates for d1n7da3.
(The format of our PDB-style files is described here.)

Timeline for d1n7da3: