PDB entry 1n7d

View 1n7d on RCSB PDB site
Description: extracellular domain of the ldl receptor
Deposited on 2002-11-13, released 2003-01-21
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-21, with a file datestamp of 2003-01-21.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.381
AEROSPACI score: -0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n7dA (A:)
    svtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgcppktcsqdefrchdgkcisr
    qfvcdsdrdcldgsdeascpvltcgpasfqcnsstcipqlwacdndpdcedgsdewpqrc
    rglyvfqgdsspcsafefhclsgecihsswrcdggpdckdksdeencavatcrpdefqcs
    dgncihgsrqcdreydckdmsdevgcvnvtlcegpnkfkchsgecitldkvcnmardcrd
    wsdepikecgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtc
    sqlcvnleggykcqceegfqldphtkackavgsiaylfftnrhevrkmtldrseytslip
    nlrnvvaldtevasnriywsdlsqrmicstqldrahgvssydtvisrdiqapdglavdwi
    hsniywtdsvlgtvsvadtkgvkrktlfreqgskpraivvdpvhgfmywtdwgtpakikk
    gglngvdiyslvteniqwpngitldllsgrlywvdsklhsissidvnggnrktiledekr
    lahpfslavfedkvfwtdiineaifsanrltgsdvnllaenllspedmvlfhqltqprgv
    nwcerttlsnggcqylclpapqinphspkftcacpdgmllardmrsclte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7dA (A:)
    svtcksgdfscggnrcipqfwrcdgqvdcngsdeqgcppktcsqdefrchdgrqfvcdsd
    rdcldgsdeascpvltcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrglyvfq
    gdsspcsafefhclsgecihsswrcdggpdckdksdeencavatcrpdefqcsdgncihg
    srqcdreydckdmsdevgcvnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepik
    ecgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnl
    eggykcqceegfqldphtkackavgsiaylfftnrherkmtldrseytslipnlrnvval
    dtevasnriywsdlsqrmicstqldrahgssydtvisrdipdglavdwihsniywtdsvl
    gtvsvadtkgvkrktlfreqgskpraivvdpvhgfmywtdwgtpakikkgglngvdiysl
    vteniqwpngitldllsgrlywvdsklhsissidvnggnrktiledekrlahpfslavfe
    dkvfwtdiineaifsanrltgsdvnllaenllspedmvlfhqltqprgvnwcerttlsng
    gcqylclpapqinphspkftcacpdgmllardmrsclte