![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.12: LDL receptor-like module [57423] (1 superfamily) |
![]() | Superfamily g.12.1: LDL receptor-like module [57424] (1 family) ![]() |
![]() | Family g.12.1.1: LDL receptor-like module [57425] (2 proteins) |
![]() | Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57427] (10 PDB entries) |
![]() | Domain d1n7da7: 1n7d A:125-174 [80242] Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4 |
PDB Entry: 1n7d (more details), 3.7 Å
SCOP Domain Sequences for d1n7da7:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7da7 g.12.1.1 (A:125-174) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)} ltcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrglyvfqgdss
Timeline for d1n7da7: