Lineage for d1n7da1 (1n7d A:377-642)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233193Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 233332Superfamily b.68.5: Low density lipoprotein (LDL) receptor YWTD domain [63825] (1 family) (S)
  5. 233333Family b.68.5.1: Low density lipoprotein (LDL) receptor YWTD domain [63826] (1 protein)
  6. 233334Protein Low density lipoprotein (LDL) receptor YWTD domain [63827] (1 species)
  7. 233335Species Human (Homo sapiens) [TaxId:9606] [63828] (2 PDB entries)
  8. 233338Domain d1n7da1: 1n7d A:377-642 [80236]
    Other proteins in same PDB: d1n7da2, d1n7da3, d1n7da4, d1n7da5, d1n7da6, d1n7da7, d1n7da8, d1n7da9, d1n7daa
    complexed with ca, keg, man, nag; mutant

Details for d1n7da1

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor

SCOP Domain Sequences for d1n7da1:

Sequence, based on SEQRES records: (download)

>d1n7da1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor YWTD domain {Human (Homo sapiens)}
iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqld
rahgvssydtvisrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfreqgs
kpraivvdpvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlyw
vdsklhsissidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgs
dvnllaenllspedmvlfhqltqprg

Sequence, based on observed residues (ATOM records): (download)

>d1n7da1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor YWTD domain {Human (Homo sapiens)}
iaylfftnrherkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqldr
ahgssydtvisrdipdglavdwihsniywtdsvlgtvsvadtkgvkrktlfreqgskpra
ivvdpvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlywvdsk
lhsissidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgsdvnl
laenllspedmvlfhqltqprg

SCOP Domain Coordinates for d1n7da1:

Click to download the PDB-style file with coordinates for d1n7da1.
(The format of our PDB-style files is described here.)

Timeline for d1n7da1: