SCOP 1.65: Domain d1n32e1: 1n32 E:74-154

Lineage for d1n32e1 (1n32 E:74-154)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (14 PDB entries)

8. Domain d1n32e1: 1n32 E:74-154 [79873]
   Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
   complexed with mg, par, psu, zn

Details for d1n32e1

PDB Entry: 1n32, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32e1:

Sequence; same for both SEQRES and ATOM records:

>d1n32e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d1n32e1:

• d1n32e1 first appeared in SCOP 1.63
  
• d1n32e1 appears in SCOP 1.67
  
• d1n32e1 appears in the current release, SCOPe 2.08