Lineage for d1n32s_ (1n32 S:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327487Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 327488Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 327489Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 327490Protein Ribosomal protein S19 [54572] (1 species)
  7. 327491Species Thermus thermophilus [TaxId:274] [54573] (16 PDB entries)
  8. 327493Domain d1n32s_: 1n32 S: [79888]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32t_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32s_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1n32s_:

Click to download the PDB-style file with coordinates for d1n32s_.
(The format of our PDB-style files is described here.)

Timeline for d1n32s_: