Lineage for d1n32p_ (1n32 P:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327467Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 327468Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 327469Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 327470Protein Ribosomal protein S16 [54567] (1 species)
  7. 327471Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries)
  8. 327473Domain d1n32p_: 1n32 P: [79885]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32p_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1n32p_:

Click to download the PDB-style file with coordinates for d1n32p_.
(The format of our PDB-style files is described here.)

Timeline for d1n32p_: