Lineage for d1n32f_ (1n32 F:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329472Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 329473Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 329474Protein Ribosomal protein S6 [54997] (1 species)
  7. 329475Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries)
  8. 329479Domain d1n32f_: 1n32 F: [79875]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32f_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1n32f_:

Click to download the PDB-style file with coordinates for d1n32f_.
(The format of our PDB-style files is described here.)

Timeline for d1n32f_: