Lineage for d1n32g_ (1n32 G:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283267Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 283268Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 283269Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 283270Protein Ribosomal protein S7 [47975] (3 species)
  7. 283275Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries)
  8. 283278Domain d1n32g_: 1n32 G: [79876]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, psu, zn

Details for d1n32g_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1n32g_:

Click to download the PDB-style file with coordinates for d1n32g_.
(The format of our PDB-style files is described here.)

Timeline for d1n32g_: