Lineage for d1mjea5 (1mje A:2971-3110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. Protein OB-fold domains of BRCA2, C-terminal domain [418919] (2 species)
    protein duplication: tandem repeat of three OB-fold domains
  7. Species Mouse (Mus musculus) [TaxId:10090] [419345] (2 PDB entries)
  8. 2789373Domain d1mjea5: 1mje A:2971-3110 [79197]
    Other proteins in same PDB: d1mjea1, d1mjea2, d1mjea3, d1mjea4
    complex with ssDNA
    protein/DNA complex
    has additional insertions and/or extensions that are not grouped together

Details for d1mjea5

PDB Entry: 1mje (more details), 3.5 Å

PDB Description: structure of a brca2-dss1-ssdna complex
PDB Compounds: (A:) breast cancer 2

SCOPe Domain Sequences for d1mjea5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjea5 b.40.4.3 (A:2971-3110) OB-fold domains of BRCA2, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
reslhfsrlsdpafqppcsevdvvgvvvsvvkpiglaplvylsdeclnllvvkfgidlne
dikprvliaasnlqcqpestsgvptlfachfsifsaspkeayfqekvnnlkhaienidtf
ykeaekklihvlegdspkw

SCOPe Domain Coordinates for d1mjea5:

Click to download the PDB-style file with coordinates for d1mjea5.
(The format of our PDB-style files is described here.)

Timeline for d1mjea5: