SCOPe 2.08: Domain d1mjea2: 1mje A:2752-2887

Lineage for d1mjea2 (1mje A:2752-2887)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.171: BRCA2 tower domain [81877] (1 superfamily)
   multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices

4. Superfamily a.171.1: BRCA2 tower domain [81878] (1 family)

5. Family a.171.1.1: BRCA2 tower domain [81879] (1 protein)

6. Protein BRCA2 tower domain [81880] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [81881] (2 PDB entries)

8. Domain d1mjea2: 1mje A:2752-2887 [79194]
   Other proteins in same PDB: d1mjea1, d1mjea3, d1mjea4, d1mjea5
   this domain is partly disordered in the crystal structure
   protein/DNA complex
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1mjea2

PDB Entry: 1mje, 3.5 Å

PDB Description: structure of a brca2-dss1-ssdna complex

PDB Compounds: (A:) breast cancer 2

SCOPe Domain Sequences for d1mjea2:

Sequence, based on SEQRES records:

>d1mjea2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus) [TaxId: 10090]}
vektvsglyifrsereeekealrfaeaqqkklealftkvhteglsrdvt

Sequence, based on observed residues (ATOM records):

>d1mjea2 a.171.1.1 (A:2752-2887) BRCA2 tower domain {Mouse (Mus musculus) [TaxId: 10090]}
vektvsglyifrsereeekealrfaeaqqkklealftkvhtlsrdvt

Timeline for d1mjea2:

• d1mjea2 first appeared in SCOP 1.63
  
• d1mjea2 appears in SCOPe 2.07