Class a: All alpha proteins [46456] (290 folds) |
Fold a.170: BRCA2 helical domain [81871] (1 superfamily) multihelical; contains a 3-helical bundle surrounded by several shorter helices |
Superfamily a.170.1: BRCA2 helical domain [81872] (1 family) automatically mapped to Pfam PF09169 |
Family a.170.1.1: BRCA2 helical domain [81873] (1 protein) |
Protein BRCA2 helical domain [81874] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81875] (2 PDB entries) |
Domain d1mjea1: 1mje A:2399-2589 [79193] Other proteins in same PDB: d1mjea2, d1mjea3, d1mjea4, d1mjea5 complexed with human Dss1 fragment, chain B protein/DNA complex |
PDB Entry: 1mje (more details), 3.5 Å
SCOPe Domain Sequences for d1mjea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjea1 a.170.1.1 (A:2399-2589) BRCA2 helical domain {Mouse (Mus musculus) [TaxId: 10090]} kdlmsslqsardlqdmriknkerrhlrlqpgslyltksstlprislqaavgdrapsacsp kqlyiygvskecinvnsknaeyfqfdiqdhfgkedlcagkgfqladggwlipsndgkagk eefyralcdtpgvdpklissiwvanhyrwivwklaamefafpkefanrclnpervllqlk yrydveidnsr
Timeline for d1mjea1:
View in 3D Domains from same chain: (mouse over for more information) d1mjea2, d1mjea3, d1mjea4, d1mjea5 |