![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries) |
![]() | Domain d1kb9a1: 1kb9 A:27-239 [77311] Other proteins in same PDB: d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_ complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6 |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOPe Domain Sequences for d1kb9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna vvvgtgnikhedlvnsiesknlslqtgtkpvlk
Timeline for d1kb9a1: