![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
![]() | Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
![]() | Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries) |
![]() | Domain d1kb9e2: 1kb9 E:31-86 [77320] Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_ complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6 |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOPe Domain Sequences for d1kb9e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata
Timeline for d1kb9e2: