![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (4 PDB entries) |
![]() | Domain d1kb9i_: 1kb9 I: [77324] Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9j_, d1kb9k_ complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6 |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOPe Domain Sequences for d1kb9i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9i_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d1kb9i_: