Lineage for d1ezvc2 (1ezv C:262-385)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341239Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 341240Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 341241Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (1 protein)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 341242Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 341243Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (4 PDB entries)
  8. 341244Domain d1ezvc2: 1ezv C:262-385 [75833]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezvc2

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvc2 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOP Domain Coordinates for d1ezvc2:

Click to download the PDB-style file with coordinates for d1ezvc2.
(The format of our PDB-style files is described here.)

Timeline for d1ezvc2: