![]() | Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (1 protein) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (4 PDB entries) |
![]() | Domain d1ezvc2: 1ezv C:262-385 [75833] Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_ complexed with fes, hem, sma, uq6 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOP Domain Sequences for d1ezvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezvc2 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig rvnk
Timeline for d1ezvc2: