Lineage for d1ezvd1 (1ezv D:62-260)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277141Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 277142Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 277439Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 277440Protein Cytochrome bc1 domain [46677] (3 species)
  7. 277441Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (4 PDB entries)
  8. 277442Domain d1ezvd1: 1ezv D:62-260 [59546]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezvd1

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvd1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae)}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOP Domain Coordinates for d1ezvd1:

Click to download the PDB-style file with coordinates for d1ezvd1.
(The format of our PDB-style files is described here.)

Timeline for d1ezvd1: