Lineage for d1ezvy_ (1ezv Y:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288165Domain d1ezvy_: 1ezv Y: [59555]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_
    part of Fv against Rieske protein from the yeast cytochrome bc1 complex
    complexed with fes, hem, sma, uq6

Details for d1ezvy_

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvy_ b.1.1.1 (Y:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik

SCOP Domain Coordinates for d1ezvy_:

Click to download the PDB-style file with coordinates for d1ezvy_.
(The format of our PDB-style files is described here.)

Timeline for d1ezvy_: